PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR04G16350.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family GATA
Protein Properties Length: 451aa    MW: 47178 Da    PI: 7.5247
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR04G16350.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA603.1e-19362396135
             GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                      Cs+Cg+ kTp+WR gp+g ktLCnaCG++y++ +l
  LPERR04G16350.1 362 CSHCGVQKTPQWRAGPEGAKTLCNACGVRYKSGRL 396
                      *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011412.018356392IPR000679Zinc finger, GATA-type
SMARTSM004012.6E-18356410IPR000679Zinc finger, GATA-type
SuperFamilySSF577163.75E-14359419No hitNo description
Gene3DG3DSA:3.30.50.102.1E-15360394IPR013088Zinc finger, NHR/GATA-type
CDDcd002022.47E-15361418No hitNo description
PROSITE patternPS003440362387IPR000679Zinc finger, GATA-type
PfamPF003203.2E-17362396IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 451 aa     Download sequence    Send to blast
MLHQTLIPSS PLSSALSPPP LLFASNAAAA TTTAQGSDTF RTSAMPSYAH HHSSLDGKME  60
PLKSSCRSED AADEGAAVAP AEWAMADRDG FDVEDLLDLE EFVEVDKDGA DEQAPVAAAP  120
EEEKPKDDSP QQSSVVSYEL VPLPPPPPEI VDLPAHDVEE LEWVSHIMDD SLSELPPPPQ  180
PPASLVAAAA RPPLRRLPQD GAYRALPLPP PASYPLLRTP TICALSTEAL VPVTAKRSKR  240
SRSSAWSLSG ASPFSDSTSS SSTTTTTSSC SSSAGSFSRA SSAAPFSPLL KWQPLGSSDL  300
SEDYQLLMTP PPPGKKSKHG KNGGGKNGKP KKRGRKPKQL PPNPSAAAGA AAAAPAPGDR  360
RCSHCGVQKT PQWRAGPEGA KTLCNACGVR YKSGRLLPEY RPACSPTYVS AIHSNSHRKV  420
LEMRRKKEAG TGTGTGILAA AAAAVPAVAS F
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015692212.11e-164PREDICTED: GATA transcription factor 5-like
TrEMBLA0A0D9W7P00.0A0A0D9W7P0_9ORYZ; Uncharacterized protein
STRINGOB04G27190.11e-163(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP141733108
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.22e-38GATA transcription factor 5